AaTX1
 | This article, AaTX1, has recently been created via the Articles for creation process. Please check to see if the reviewer has accidentally left this template after accepting the draft and take appropriate action as necessary.
Reviewer tools: Inform author |
AaTX1 is a scorpion toxin of the α-KTx15 subfamily originally found in the venom of Androctonus australis. The toxin acts as a specific blocker on Kv4.3 voltage-gated potassium channel, thereby abolishing the A-type potassium current amplitude through this channel.
| Superfamily | Short Scorpion Toxins |
|---|---|
| Family | Scorpion Toxins |
| Subfamily | α-KTx15 |
| Amino acid sequence | ZIETNKKCQGGSCASVCKKVIGVAAGKCINGRCVCYP[1] |
| Molecular weight | 3851 Da |
Etymology and Source
AaTX1 is a peptide that can be purified from the venom of Androctonus australis.[1] Androctonus australis is a fat-tailed desert scorpion distributed over North Africa and the Middle East. The venom of this species consists of only 0.007% (w/v) AaTX1.[1]
Chemistry
The peptide consists of 37 amino acid residues, which include six cysteines. These cysteines form disulphide bridges, cross-linking the residues along the peptidyl chain. The determined molecular mass of the peptide appears to be approximately 3851 Da. AaTX1 is a member of the α-KTx15 subfamily. This family consists of six peptides, which share high level of sequence similarity: Aa1, AaTX1, AaTX2, AmmTX3, BmTX3 and Discrepin. More specifically, AaTX1 shares the highest percentage of sequence identity (97%) with AmmTX3, differing in only one conserved amino acid (R in AmmTX3/K in AaTX1) in position 19.[1]
The 3D structure of AaTX1 has been solved. The toxin appears to have the characteristic folding of K+ channel scorpion toxins, consisting of a double-stranded antiparallel β-sheet and an α-helix. Furthermore, AaTX1 contains the amino acid dyad (K27, Y36) typically found in pore-blocking potassium channel-specific toxins.[1]
Target
AaTX1 is a specific pore-blocker of Kv4.3 potassium channels in dopaminergic neurons, where the β-sheet of the peptide interacts with the residues of the channel selectivity filter. The electrostatic interaction between the toxin and the Kv4.3 potassium channel is subserved by a specific residue (pGlu1), which is entrapped between two positively residues of the channel.[1] The substitution of K19 in AaTX1 by R19 in AmmTX3 is located far from the interaction surface with the Kv4.3 potassium channel, therefore the interaction appears to be identical for both toxins.[1]
Mode of action
By acting as a specific pore-blocker of Kv4.3 potassium channels, AaTX1 inhibits the IA current through these channels. IA currents, mediated by these specific channels, are crucial for the repolarization after an action potential has occurred. The action of AaTX1 on IA currents’ amplitude in a cell depends on the specific channel types expressed in that cell which mediate this current. The dopaminergic neurons of the substantia nigra express Kv4.3 potassium channels; therefore, in these neurons AaTX1 abolishes approximately the entire IA current through these channels.[1]
Toxicity
At a concentration of 253 nM, AaTX1 decreases the IA current amplitude by 90%.[1]
References
- ^ a b c d e f g h i Mlayah-Bellalouna, Saoussen; Dufour, Martial; Mabrouk, Kamel; Mejdoub, Hafedh; Carlier, Edmond; Othman, Houcemeddine; Belghazi, Maya; Tarbe, Marion; Goaillard, Jean Marc. "AaTX1, from Androctonus australis scorpion venom: Purification, synthesis and characterization in dopaminergic neurons". Toxicon. 92: 14–23. doi:10.1016/j.toxicon.2014.09.005.
| This article, AaTX1, has recently been created via the Articles for creation process. Please check to see if the reviewer has accidentally left this template after accepting the draft and take appropriate action as necessary.
Reviewer tools: Inform author |