Jump to content

Candidate division SR1 and gracilibacteria code

Add links
From Wikipedia, the free encyclopedia

This is an old revision of this page, as edited by Manudouz (talk | contribs) at 08:48, 26 February 2019 (→References: Updating NCBI content.). The present address (URL) is a permanent link to this revision, which may differ significantly from the current revision.

The candidate division SR1 and gracilibacteria code (translation table 25) is used in two groups of (so far) uncultivated bacteria found in marine and fresh-water environments and in the intestines and oral cavities of mammals among others[1]. The difference to the standard and the bacterial code is that UGA represents an additional glycine codon and does not code for termination.[2]

The code

   AAs = FFLLSSSSYY**CCGWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = ---M-------------------------------M---------------M------------
 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (Val, V).

Difference from the standard code

DNA codon RNA codon This code (25) Standard code (1)
TGA UGA Gly (G) STOP = Ter (*)

Initiation codons

  • AUG, GUG, UUG

Systematic range

See also

References

This article incorporates text from the United States National Library of Medicine, which is in the public domain. [3]

  1. ^ Davis, James P.; Youssef, Noha H.; Elshahed, Mostafa S. (June 2009). "Assessment of the diversity, abundance, and ecological distribution of members of candidate division SR1 reveals a high level of phylogenetic diversity but limited morphotypic diversity". Applied and Environmental Microbiology. 75 (12): 4139–4148. doi:10.1128/AEM.00137-09. ISSN 1098-5336. PMC 2698373. PMID 19395567.
  2. ^ J. H. Campbell; O'P. Donoghue; A. G. Campbell; P. Schwientek; A. Sczyrba; T. Woyke; D. Söll; M. Podar (2 April 2013). "UGA is an additional glycine codon in uncultured SR1 bacteria from the human microbiota". Proc Natl Acad Sci U S A. 110 (14): 5540–5. doi:10.1073/pnas.1303090110. PMC 3619370. PMID 23509275.
  3. ^ Elzanowski, Andrzej; Ostell, Jim; Leipe, Detlef; Soussov, Vladimir. "The Genetic Codes". Taxonomy browser. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine. Retrieved 19 March 2016. {{cite web}}: Unknown parameter |name-list-format= ignored (|name-list-style= suggested) (help)
Retrieved from "https://en.wikipedia.org/w/index.php?title=Candidate_division_SR1_and_gracilibacteria_code&oldid=885155735"