Jump to content

Ciliate, dasycladacean and hexamita nuclear code

Add links
From Wikipedia, the free encyclopedia

This is an old revision of this page, as edited by Rjwilmsi (talk | contribs) at 15:17, 28 July 2016 (→Systematic range: Journal cites, Added 2 dois to journal cites using AWB (12058)). The present address (URL) is a permanent link to this revision, which may differ significantly from the current revision.

The ciliate, dasycladacean and hexamita nuclear code (translation table 6) is a genetic code used by certain ciliate, dasycladacean and hexamita species.

The ciliate macronuclear code has not been determined completely. The codon UAA is known to code for Gln only in the Oxytrichidae.

The code

   AAs = FFLLSSSSYYQQCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG

Starts = -----------------------------------M----------------------------

 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG

 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG

 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)


Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)


Differences from the standard code:
This code Standard
UAA Gln Q Ter *
UAG Gln Q Ter *

Systematic range

See also

References

  • This article contains public domain text from the NCBI page compiled by Andrzej (Anjay) Elzanowski and Jim Ostell.[4]
  1. ^ Hoffman DC, Anderson RC, DuBois ML, Prescott DM (1995). "Macronuclear gene-sized molecules of hypotrichs". Nucleic Acids Research. 23 (8): 1279–83. doi:10.1093/nar/23.8.1279. PMC 306850. PMID 7753617.
  2. ^ Schneider SU, Leible MB, Yang XP (1989). "Strong homology between the small subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase of two species of Acetabularia and the occurrence of unusual codon usage". Molecular & General Genetics. 218 (3): 445–52. doi:10.1007/bf00332408. PMID 2573818.
  3. ^ Schneider SU, de Groot EJ (1991). "Sequences of two rbcS cDNA clones of Batophora oerstedii: structural and evolutionary considerations". Current Genetics. 20 (1–2): 173–5. doi:10.1007/bf00312782. PMID 1934113.
  4. ^ "The Genetic Codes". Retrieved 29 January 2016.

Retrieved from "https://en.wikipedia.org/w/index.php?title=Ciliate,_dasycladacean_and_hexamita_nuclear_code&oldid=731945732"