Corticotropin-releasing hormone

From Wikipedia, the free encyclopedia
  (Redirected from Corticotropin releasing hormone)
Jump to: navigation, search
Corticotropin releasing hormone

PDB rendering based on 1go9.
Identifiers
Symbols CRH; CRF
External IDs OMIM122560 MGI88496 HomoloGene599 GeneCards: CRH Gene
RNA expression pattern
PBB GE CRH 205630 at tn.png
PBB GE CRH 205629 s at tn.png
More reference expression data
Orthologs
Species Human Mouse
Entrez 1392 12918
Ensembl ENSG00000147571 ENSMUSG00000049796
UniProt P06850 Q14AA2
RefSeq (mRNA) NM_000756.2 NM_205769.2
RefSeq (protein) NP_000747.1 NP_991338.1
Location (UCSC) Chr 8:
67.09 – 67.09 Mb
Chr 3:
19.59 – 19.6 Mb
PubMed search [1] [2]

Corticotropin-releasing hormone (CRH), originally named corticotropin-releasing factor (CRF), and also called corticoliberin, is a polypeptide hormone and neurotransmitter involved in the stress response. It belongs to corticotropin-releasing factor family.

Its main function is the stimulation of the pituitary synthesis of ACTH.

Corticotropin-releasing hormone (CRH) is a 41-amino acid peptide derived from a 191-amino acid preprohormone. CRH is secreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Marked reduction in CRH has been observed in association with Alzheimer's disease, and autosomal recessive hypothalamic corticotropin deficiency[citation needed] has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to being produced in the hypothalamus, CRH is also synthesized in peripheral tissues, such as T lymphocytes, and is highly expressed in the placenta. In the placenta, CRH is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of CRH occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, CRH may act as a trigger for parturition.[1]

Contents

[edit] Hormonal actions

CRH is produced by parvocellular neuroendocrine cells (which are contained within the paraventricular nucleus) of the hypothalamus and is released at the median eminence from neurosecretory terminals of these neurons into the primary capillary plexus of the hypothalamo-hypophyseal portal system. The portal system carries the CRH to the anterior lobe of the pituitary, where it stimulates corticotropes to secrete adrenocorticotrophic hormone (ACTH) and other biologically-active substances β-endorphin). ACTH stimulates the synthesis of cortisol, glucocorticoids, mineralocorticoids and DHEA; therefore high CRF levels are very common in individuals with Cushing's syndrome.

α-helical CRH-(9–41) acts as a CRH antagonist.[2]

[edit] Psychopharmacology

The CRH-1 receptor antagonist pexacerfont is currently under investigation for the treatment of generalized anxiety disorder in women.[3] Another CRH-1 antagonist antalarmin has been researched in animal studies for the treatment of anxiety, depression and other conditions, but no human trials with this compound have been carried out.

Also, abnormally high levels of CRH have been found in the cerebrospinal fluid of suicide victims.[4]

Recent research has linked the activation of the CRH1 receptor with the euphoric feelings that accompany alcohol consumption. A CRH1 receptor antagonist developed by Pfizer, CP-154,526 is under investigation for the potential treatment of alcoholism.[5][6]

[edit] Role in parturition

CRH is also synthesized by the placenta and seems to determine the duration of pregnancy.[7]

Levels rise towards the end of pregnancy just before birth and current theory suggests three roles of CRH in parturition:[8]

  • Increases levels of dehydroepiandrosterone (DHEA) directly by action on the fetal adrenal gland, and indirectly via the mother's pituitary gland. DHEA has a role in preparing for and stimulating cervical contractions.
  • Increases prostaglandin availability in uteroplacental tissues. Prostaglandins activate cervical contractions.
  • Prior to parturition it may have a role inhibiting contractions, through increasing cAMP levels in the myometrium.

In culture, trophoblast CRH is inhibited by progesterone, which remains high throughout pregnancy. Its release is stimultated by glucocorticoids and catecholamines, which increase prior to parturition lifting this progesterone block.[9]

[edit] Structure

The 41-amino acid sequence of CRH was first discovered in sheep by Vale et al. in 1981.[10] Its full sequence is:

  • SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA

The rat and human peptides are identical and differ from the ovine sequence only by 7 amino acids.[11]

  • SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

[edit] See also


[edit] Interactions

Corticotropin-releasing hormone has been shown to interact with Corticotropin releasing hormone receptor 1.[12][13]

[edit] References

  1. ^ "Entrez Gene: CRH corticotropin releasing hormone". http://www.ncbi.nlm.nih.gov/sites/entrez?Db=gene&Cmd=ShowDetailView&TermToSearch=1392. 
  2. ^ Santos J, Saunders PR, Hanssen NP, Yang PC, Yates D, Groot JA, Perdue MH (1 August 1999). "Corticotropin-releasing hormone mimics stress-induced colonic epithelial pathophysiology in the rat". Am. J. Physiol. 277 (2 Pt 1): G391–9. PMID 10444454. http://ajpgi.physiology.org/cgi/content/abstract/277/2/G391. 
  3. ^ "Study of Pexacerfont (BMS-562086) in the Treatment of Outpatients With Generalized Anxiety Disorder". ClinicalTrials.gov. 2008-08-01. http://www.clinicaltrials.gov/ct/show/NCT00481325?order=31. Retrieved 2008-08-03. 
  4. ^ Arató M, Bánki CM, Bissette G, Nemeroff CB (1989). "Elevated CSF CRF in suicide victims". Biol. Psychiatry 25 (3): 355–9. doi:10.1016/0006-3223(89)90183-2. PMID 2536563. 
  5. ^ "Drug Has Potential To Prevent Alcoholics From Relapsing". Science News. ScienceDaily. 2008-08-02. http://www.sciencedaily.com/releases/2008/07/080730175518.htm. Retrieved 2008-08-09. 
  6. ^ Pastor R, McKinnon CS, Scibelli AC, Burkhart-Kasch S, Reed C, Ryabinin AE, Coste SC, Stenzel-Poore MP, Phillips TJ (July 2008). "Corticotropin-releasing factor-1 receptor involvement in behavioral neuroadaptation to ethanol: a urocortin1-independent mechanism". Proc. Natl. Acad. Sci. U.S.A. 105 (26): 9070–5. doi:10.1073/pnas.0710181105. PMC 2449366. PMID 18591672. http://www.pubmedcentral.nih.gov/articlerender.fcgi?tool=pmcentrez&artid=2449366. 
  7. ^ Kimball JW (2006-06-15). "Hormones of the Hypothalamus". Kimball's Biology Pages. http://users.rcn.com/jkimball.ma.ultranet/BiologyPages/H/Hypothalamus.html#CRH. Retrieved 2008-08-03. 
  8. ^ Lye S, Challis JRG (2001). "Chapter 12: Parturition". In Bocking AD, Harding R. Fetal growth and development. Cambridge, UK: Cambridge University Press. pp. 241–266. ISBN 0-521-64543-3. 
  9. ^ Jones SA, Brooks AN, Challis JR (April 1989). "Steroids modulate corticotropin-releasing hormone production in human fetal membranes and placenta". J. Clin. Endocrinol. Metab. 68 (4): 825–30. doi:10.1210/jcem-68-4-825. PMID 2537843. 
  10. ^ Vale W, Spiess J, Rivier C, Rivier J (September 1981). "Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin". Science 213 (4514): 1394–7. doi:10.1126/science.6267699. PMID 6267699. http://www.sciencemag.org/cgi/pmidlookup?view=long&pmid=6267699. 
  11. ^ Chrousos GP, Schuermeyer TH, Doppman J, Oldfield EH, Schulte HM, Gold PW, Loriaux DL (March 1985). "NIH conference. Clinical applications of corticotropin-releasing factor.". Annals of internal medicine 102 (3): 344–358. PMID 2982307. http://www.ncbi.nlm.nih.gov/pubmed/2982307. 
  12. ^ Grammatopoulos, D K; Dai Y, Randeva H S, Levine M A, Karteris E, Easton A J, Hillhouse E W (Dec. 1999). "A novel spliced variant of the type 1 corticotropin-releasing hormone receptor with a deletion in the seventh transmembrane domain present in the human pregnant term myometrium and fetal membranes". Mol. Endocrinol. (UNITED STATES) 13 (12): 2189–202. doi:10.1210/me.13.12.2189. ISSN 0888-8809. PMID 10598591. 
  13. ^ Gottowik, J; Goetschy V, Henriot S, Kitas E, Fluhman B, Clerc R G, Moreau J L, Monsma F J, Kilpatrick G J (Oct. 1997). "Labelling of CRF1 and CRF2 receptors using the novel radioligand, [3H]-urocortin". Neuropharmacology (ENGLAND) 36 (10): 1439–46. doi:10.1016/S0028-3908(97)00098-1. ISSN 0028-3908. PMID 9423932. 

[edit] Further reading

Personal tools
Namespaces
Variants
Actions
Navigation
Interaction
Toolbox
Print/export
Languages